PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_008419-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 897aa    MW: 98686.8 Da    PI: 6.3103
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_008419-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.43.5e-34616672259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    dDgynWrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers  d++v+ei+Y+g+Hnh+
  NNU_008419-RA 616 DDGYNWRKYGQKQVKGSEFPRSYYKCTHSNCPVKKKVERSP-DGQVTEIIYKGQHNHP 672
                    8****************************************.***************8 PP

2WRKY105.42.9e-33783841159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Ct agC+v+k+ver+++dpk+v++tYeg+Hnh+
  NNU_008419-RA 783 LDDGYRWRKYGQKVVKGNPYPRSYYKCTNAGCNVRKHVERASTDPKAVITTYEGKHNHD 841
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF508148.57E-1875184IPR011038Calycin-like
Gene3DG3DSA:2.40.128.201.4E-2480268IPR012674Calycin
SuperFamilySSF508148.57E-18211268IPR011038Calycin-like
SuperFamilySSF508147.67E-10283368IPR011038Calycin-like
Gene3DG3DSA:2.40.128.205.4E-15284368IPR012674Calycin
Gene3DG3DSA:2.20.25.802.8E-30602675IPR003657WRKY domain
PROSITE profilePS5081124.604610674IPR003657WRKY domain
SuperFamilySSF1182901.31E-26613674IPR003657WRKY domain
SMARTSM007741.8E-38615673IPR003657WRKY domain
PfamPF031068.8E-27616672IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.3E-35775843IPR003657WRKY domain
SuperFamilySSF1182904.71E-29776843IPR003657WRKY domain
PROSITE profilePS5081138.916778843IPR003657WRKY domain
SMARTSM007742.0E-39783842IPR003657WRKY domain
PfamPF031065.6E-26784841IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 897 aa     Download sequence    Send to blast
MKLPVMAAIS SISVAPMTKT PVSNLTPKFY VNFSTSKSFL RSSSSFRRPR IQAVKPSSFV  60
SEEQHKRDEE SMSIDNLHRF IALNLGNWNG SFYVSVNSSI ISSLFSNFQF DPYGNLLQKV  120
TTRLAVSSYG EDELISLIQT LYIKQPSSSA STSGYDSEPE WAEYKIKETN MFTVDNYQQI  180
GFFPKERAFS LRYQTAGMLE TVLRQGILGE DDIGEESPKN LKLPSQRPSV VCENCLYSQE  240
KDMRARVFHI LDPKGVLEML LVFLEERGNE LTLPSSLDNA KNSTNRIQPF LGRWKGHSIT  300
KRSGVYGATI VEADTIALLE IDDNGQLIQD ITSTSDGGDV ATTVHWTGHL LDNLITFDGG  360
YQMTLLPGDS IQSSSMAEND RSQRPAAPPR PTIALPSRSS VESLFTGGAG TSPGPMTLVN  420
NFFSENDPES DCRSFSQLLA GAMASPVSVA GMRPNFFTDN STQESSKQKD SGDGGEKDFC  480
LKPQRPLNLV IAQSPLPMFT IPPGLSPATL LDSPGFFSPG QGPFGMSHQQ ALAQVTAQAA  540
QSQSYMPIQG EYPSSVLVPP TTSLVQHVPF SINGPSHQHI PPSTSDSKGT IVESSEFSNS  600
EQRSQPASSA VEKPADDGYN WRKYGQKQVK GSEFPRSYYK CTHSNCPVKK KVERSPDGQV  660
TEIIYKGQHN HPQPQPNKRA KESGNSNASL SLQGKPEFGS RVQSGNLNGP NENITSSSLY  720
RKEQESSQAT PEQLSGSSDG EEVGDAETRV DEGDDDEPDS KRRHVLHLIT SPDLETTSEV  780
DLLDDGYRWR KYGQKVVKGN PYPRSYYKCT NAGCNVRKHV ERASTDPKAV ITTYEGKHNH  840
DVPTARNNSH NTANSNMAQI KPQAAVAEKN SLLANSDIRN QDQQLVALLR LKEEKIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-38616843577Probable WRKY transcription factor 4
1wj2_A3e-38616843577Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258215.10.0PREDICTED: probable WRKY transcription factor 3 isoform X1
SwissprotQ9XI901e-147WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLV4SZH60.0V4SZH6_9R
STRINGVIT_14s0108g01280.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-126WRKY DNA-binding protein 4